PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI10G10120.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 348aa    MW: 38679.8 Da    PI: 10.4605
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI10G10120.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.53.2e-18114161148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+W++eEd++lv +++++G ++W++ ++  g+ R++k+c++rw +yl
  OMERI10G10120.1 114 RGAWSPEEDDRLVAYIRRHGHPNWRALPKQAGLLRCGKSCRLRWINYL 161
                      89******************************99************97 PP

2Myb_DNA-binding482.8e-15167209145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      rg++T++E++l+v++++ lG++ W++Ia+ m+ gRt++++k+  +
  OMERI10G10120.1 167 RGNFTADEEDLIVRLHNSLGNR-WSAIAAQMP-GRTDNEIKNQTR 209
                      89********************.*********.********9765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-24105164IPR009057Homeodomain-like
PROSITE profilePS5129423.497109165IPR017930Myb domain
SuperFamilySSF466893.48E-28111206IPR009057Homeodomain-like
SMARTSM007177.1E-13113163IPR001005SANT/Myb domain
PfamPF002499.8E-16114161IPR001005SANT/Myb domain
CDDcd001677.72E-11116161No hitNo description
Gene3DG3DSA:1.10.10.604.7E-21165208IPR009057Homeodomain-like
PROSITE profilePS5129414.691166214IPR017930Myb domain
SMARTSM007175.0E-12166214IPR001005SANT/Myb domain
PfamPF002492.0E-13167210IPR001005SANT/Myb domain
CDDcd001671.57E-9169207No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MLERRESTLL HQRMIQKRHK KEEEKKKHET RSRVSPPFAA RCSIPPRHRL RLRSAPINTR  60
HPAPNLAVLV PPPRTPCATT TPPRNSRCRR RRRRGGVSSS MGRAPCCEKE GLRRGAWSPE  120
EDDRLVAYIR RHGHPNWRAL PKQAGLLRCG KSCRLRWINY LRPDIKRGNF TADEEDLIVR  180
LHNSLGNRWS AIAAQMPGRT DNEIKNQTRK QPKAAKSAAV KREATPSVSV DTSSGVTCST  240
VTESSPSSAD GDRDQQQQQT QHVAAKEESF SSGGELPAAA AAPMAAADMD ESFWSSTEVT  300
GMMAGLGDMD EELAIAGTSS TAAARSDDME FWLKMLLESG DMRDLAVL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-2111220725119MYB TRANSFORMING PROTEIN
1mse_C9e-22112207296C-Myb DNA-Binding Domain
1msf_C9e-22112207296C-Myb DNA-Binding Domain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18893RRRRRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126180.0CP012618.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 10 sequence.
GenBankCT8347440.0CT834744.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA107G14, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015612956.11e-147PREDICTED: myb-related protein Myb4-like
TrEMBLA0A0E0EYX90.0A0A0E0EYX9_9ORYZ; Uncharacterized protein
STRINGLOC_Os10g33810.11e-147(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.18e-63myb domain protein 15